EML2 Antibody (2H6)

Images

 
Immunohistochemistry-Paraffin: EML2 Antibody (2H6) [H00024139-M01] - Analysis of monoclonal antibody to EML2 on formalin-fixed paraffin-embedded human lung. Antibody concentration 6 ug/ml.
Sandwich ELISA: EML2 Antibody (2H6) [H00024139-M01] - Detection limit for recombinant GST tagged EML2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P, S-ELISA
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EML2 Antibody (2H6) Summary

Immunogen
EML2 (AAH32630, 1 a.a. ~ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEMAAAGHGDP
Specificity
EML2 - echinoderm microtubule associated protein like 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EML2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. It has also been used for immunohistochemistry on paraffin sections.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EML2 Antibody (2H6)

  • echinoderm microtubule associated protein like 2
  • echinoderm microtubule-associated protein-like 2
  • echinoderm MT-associaated protein (EMAP)-like protein 70
  • echinoderm MT-associated protein (EMAP)-like protein 70
  • ELP70
  • EMAP-2huEMAP-2
  • EMAP2microtubule-associated protein like echinoderm EMAP
  • EMAPL2
  • HuEMAP-2
  • TRTLT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30956
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
NB100-360
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP2-27567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-79777
Species: Hu
Applications: WB
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, BA, Flow-IC
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP2-25163
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27206
Species: Hu, Mu, Rt, Po, Bv, Ca, ChHa, Eq, Fe, Gp, Ma-Op, Pm
Applications: WB, IHC, IHC-P
NB100-56722
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS

Publications for EML2 Antibody (H00024139-M01) (0)

There are no publications for EML2 Antibody (H00024139-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EML2 Antibody (H00024139-M01) (0)

There are no reviews for EML2 Antibody (H00024139-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EML2 Antibody (H00024139-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EML2 Products

Array H00024139-M01

Bioinformatics Tool for EML2 Antibody (H00024139-M01)

Discover related pathways, diseases and genes to EML2 Antibody (H00024139-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EML2 Antibody (H00024139-M01)

Discover more about diseases related to EML2 Antibody (H00024139-M01).
 

Pathways for EML2 Antibody (H00024139-M01)

View related products by pathway.

PTMs for EML2 Antibody (H00024139-M01)

Learn more about PTMs related to EML2 Antibody (H00024139-M01).
 

Research Areas for EML2 Antibody (H00024139-M01)

Find related products by research area.

Blogs on EML2

There are no specific blogs for EML2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EML2 Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol EML2
Entrez
Uniprot