EMI1 Antibody (5H7)

Sandwich ELISA: EMI1 Antibody (5H7) [H00026271-M01] - Detection limit for recombinant GST tagged FBXO5 is 3 ng/ml as a capture antibody.

Product Discontinued

EMI1 Antibody (5H7) Summary

• Immunogen: FBXO5 (NP_036309, 358 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRR
• Marker: Mitosis Marker
• Specificity: FBXO5 - F-box protein 5 (5H7)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FBXO5
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMI1 Antibody (5H7)

• EMI1Early mitotic inhibitor 1
• F-box only protein 5
• F-box protein 5
• FBX5F-box protein Fbx5
• Fbxo31

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is similar to xenopus early mitotic inhibitor-1 (Emi1), which is a mitotic regulator that interacts with Cdc20 and inhibits the anaphase promoting complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO5
• OMIM:
  • 606013(Human)