EMAP-II/AIMP1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit EMAP-II/AIMP1 Antibody - BSA Free (NBP1-84851) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AIMP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EMAP-II/AIMP1 Antibody - BSA Free
Background
EMAP II (Endothelial-Monocyte-Activating Polypeptide II) is a proinflammatory cytokine and chemoattractant of macrophages and polymorphonuclear lymphocytes. EMAP II is synthesized as a 34 kDa precursor molecule which is cleaved to a biologically active 22 kDa mature polypeptide. This active protein is known to induce the procoagulant protein tissue factor on the surface of endothelial cells and modulate other properties of endothelial cells and monocytes in vitro, including the stimulation of TNF-alpha and myeloperoxidase. EMAP II activates neutrophils in vivo and induces an inflammatory reaction and tumor regression. EMAP II induces apoptosis in proliferating endothelial cells and inhibits neovascularization. This anti-angiogenic property is of interest to tumor biology. EMAP II is also a negative modulator of lung vascular growth.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Publications for EMAP-II/AIMP1 Antibody (NBP1-84851) (0)
There are no publications for EMAP-II/AIMP1 Antibody (NBP1-84851).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EMAP-II/AIMP1 Antibody (NBP1-84851) (0)
There are no reviews for EMAP-II/AIMP1 Antibody (NBP1-84851).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EMAP-II/AIMP1 Antibody (NBP1-84851) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EMAP-II/AIMP1 Products
Research Areas for EMAP-II/AIMP1 Antibody (NBP1-84851)
Find related products by research area.
|
Blogs on EMAP-II/AIMP1