EMAP-II/AIMP1 Antibody

Images

 
Western Blot: EMAP-II/AIMP1 Antibody [NBP1-84851] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: EMAP-II/AIMP1 Antibody [NBP1-84851] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: EMAP-II/AIMP1 Antibody [NBP1-84851] - Staining of human hippocampus shows distinct cytoplasmic positivity in neuronal cells.
Western Blot: EMAP-II/AIMP1 Antibody [NBP1-84851] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMAP-II/AIMP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIMP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EMAP-II/AIMP1 Protein (NBP1-84851PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMAP-II/AIMP1 Antibody

  • AIMP1
  • aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
  • EMAP-2
  • EMAPII
  • EMAP-II
  • EMAPIImember 1 (endothelialmonocyte-activating)
  • endothelial-monocyte activating polypeptide II
  • Multisynthase complex auxiliary component p43
  • multisynthetase complex auxiliary component p43
  • SCYE1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89186
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30956
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88430
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-84851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EMAP-II/AIMP1 Antibody (NBP1-84851) (0)

There are no publications for EMAP-II/AIMP1 Antibody (NBP1-84851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMAP-II/AIMP1 Antibody (NBP1-84851) (0)

There are no reviews for EMAP-II/AIMP1 Antibody (NBP1-84851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EMAP-II/AIMP1 Antibody (NBP1-84851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EMAP-II/AIMP1 Products

Bioinformatics Tool for EMAP-II/AIMP1 Antibody (NBP1-84851)

Discover related pathways, diseases and genes to EMAP-II/AIMP1 Antibody (NBP1-84851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMAP-II/AIMP1 Antibody (NBP1-84851)

Discover more about diseases related to EMAP-II/AIMP1 Antibody (NBP1-84851).
 

Pathways for EMAP-II/AIMP1 Antibody (NBP1-84851)

View related products by pathway.

PTMs for EMAP-II/AIMP1 Antibody (NBP1-84851)

Learn more about PTMs related to EMAP-II/AIMP1 Antibody (NBP1-84851).
 

Research Areas for EMAP-II/AIMP1 Antibody (NBP1-84851)

Find related products by research area.

Blogs on EMAP-II/AIMP1

There are no specific blogs for EMAP-II/AIMP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EMAP-II/AIMP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIMP1
Entrez