EMAP-II/AIMP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EMAP-II/AIMP1 Antibody [NBP1-84851] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: EMAP-II/AIMP1 Antibody [NBP1-84851] - Staining of human hippocampus shows distinct cytoplasmic positivity in neuronal cells.

Staining of human cell line U-2 OS shows localization to cytosol.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-AIMP1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMAP-II/AIMP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AIMP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EMAP-II/AIMP1 Protein (NBP1-84851PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EMAP-II/AIMP1 Antibody - BSA Free

• AIMP1
• aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
• EMAP-2
• EMAPII
• EMAP-II
• EMAPIImember 1 (endothelialmonocyte-activating)
• endothelial-monocyte activating polypeptide II
• Multisynthase complex auxiliary component p43
• multisynthetase complex auxiliary component p43
• SCYE1

Background

EMAP II (Endothelial-Monocyte-Activating Polypeptide II) is a proinflammatory cytokine and chemoattractant of macrophages and polymorphonuclear lymphocytes. EMAP II is synthesized as a 34 kDa precursor molecule which is cleaved to a biologically active 22 kDa mature polypeptide. This active protein is known to induce the procoagulant protein tissue factor on the surface of endothelial cells and modulate other properties of endothelial cells and monocytes in vitro, including the stimulation of TNF-alpha and myeloperoxidase. EMAP II activates neutrophils in vivo and induces an inflammatory reaction and tumor regression. EMAP II induces apoptosis in proliferating endothelial cells and inhibits neovascularization. This anti-angiogenic property is of interest to tumor biology. EMAP II is also a negative modulator of lung vascular growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AIMP1