ELOVL5 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5.
Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELOVL5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ELOVL5 Antibody - BSA Free
Background
ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: IP, KO, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Publications for ELOVL5 Antibody (NBP1-59539) (0)
There are no publications for ELOVL5 Antibody (NBP1-59539).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELOVL5 Antibody (NBP1-59539) (0)
There are no reviews for ELOVL5 Antibody (NBP1-59539).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ELOVL5 Antibody (NBP1-59539) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ELOVL5 Products
Research Areas for ELOVL5 Antibody (NBP1-59539)
Find related products by research area.
|
Blogs on ELOVL5