ELOVL5 Antibody - BSA Free

Western Blot: ELOVL5 Antibody [NBP1-59539] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml

Western Blot: ELOVL5 Antibody [NBP1-59539] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Western Blot: ELOVL5 Antibody [NBP1-59539] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: ELOVL5 Antibody [NBP1-59539] - Jurkat, Antibody Dilution: 1.0 ug/ml ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Western Blot: ELOVL5 Antibody [NBP1-59539] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ELOVL5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5. Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELOVL5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ELOVL5 Antibody - BSA Free

• dJ483K16.1
• EC 2.3.1.n8
• elongation of very long chain fatty acids protein 5
• ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2
• ELOVL2,3-keto acyl-CoA synthase ELOVL5
• Fatty acid elongase 1
• hELO1
• HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2
• homolog of yeast long chain polyunsaturated fatty acid elongatio
• SUR4/Elo3-like, yeast)

Background

ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELOVL5
• Uniprot:
  • Q9NYP7(Human)