ELOF1 Antibody (4F6) - Azide and BSA Free

Western Blot: ELOF1 Antibody (4F6) [H00084337-M06] - Analysis of ELOF1 expression in transfected 293T cell line by ELOF1 monoclonal antibody (M06), clone 4F6. Lane 1: ELOF1 transfected lysate (Predicted MW: 9.5 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: ELOF1 Antibody (4F6) [H00084337-M06] - Detection limit for recombinant GST tagged ELOF1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ELOF1 Antibody (4F6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ELOF1 Antibody (4F6) - Azide and BSA Free (H00084337-M06) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ELOF1 (NP_115753.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
• Specificity: This product is specific for Human ELOF1 monoclonal antibody (M06), clone 4F6 [Gene ID: 84337].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ELOF1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a full-length recombinant ELOF1.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELOF1 Antibody (4F6) - Azide and BSA Free

• ELF1
• elongation factor 1 homolog (ELF1, S. cerevisiae)
• elongation factor 1 homolog (S. cerevisiae)
• MGC4549
• transcription elongation factor 1 homolog

Background

Transcription elongation factor implicated in the maintenance of proper chromatin structure in activelytranscribed regions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELOF1
• Uniprot:
  • NP_115753.1(Human)