ELK4 Antibody - Azide and BSA Free

Western Blot: ELK4 Antibody [H00002005-B01P] - Analysis of ELK4 expression in human liver.

Immunocytochemistry/Immunofluorescence: ELK4 Antibody [H00002005-B01P] - Analysis of purified antibody to ELK4 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: ELK4 Antibody [H00002005-B01P] - Analysis of ELK4 expression in transfected 293T cell line by ELK4 polyclonal antibody. Lane 1: ELK4 transfected lysate(44.55 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ELK4 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ELK4 (NP_068567.1, 1 a.a. - 405 a.a.) full-length human protein. MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM
• Specificity: ELK4 - ELK4, ETS-domain protein (SRF accessory protein 1),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ELK4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELK4 Antibody - Azide and BSA Free

• ELK4, ETS-domain protein (SRF accessory protein 1)
• ETS-domain protein
• SAP-1
• SAP1ETS domain-containing protein Elk-4
• Serum response factor accessory protein 1
• SRF accessory protein 1

Background

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELK4
• Entrez:
  • 2005(Human)
• Uniprot:
  • NP_068567.1(Human)