ELK3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ELK3 Antibody [NBP1-83960] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ELK3 Antibody [NBP1-83960] - Staining of human appendix shows moderate nuclear positivity in lymphoid tissue.

Analysis in control (vector only transfected HEK293T lysate) and ELK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

ChIP-Exo-Seq composite graph for Anti-ELK3 (NBP1-83960) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ELK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ELK3 Antibody - BSA Free (NBP1-83960) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and ChIP. Anti-ELK3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID: 25401928)
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ELK3 Protein (NBP1-83960PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ELK3 Antibody - BSA Free

• ELK3, ETS-domain protein (SRF accessory protein 2)
• ERPETS domain-containing protein Elk-3
• ETS-domain protein
• ETS-related protein ERP
• NETSRF accessory protein 2
• SAP-2
• SAP2ETS-related protein NET
• Serum response factor accessory protein 2

Background

ELK3 is encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ELK3 Antibody (NBP1-83960)(3)

Publications using NBP1-83960

• Li TZ, Bai CY, Wu B et al. The Elk-3 target Abhd10 ameliorates hepatotoxic injury and fibrosis in alcoholic liver disease Communications biology 2023-07-03 [PMID: 37400491] (ChIP, Human)
• Liu N, He J, Fan D et al. Circular RNA circTmem241 drives group III innate lymphoid cell differentiation via initiation of Elk3 transcription Nature communications 2022-08-11 [PMID: 35953472] (WB)
• Robertson ED, Wasylyk C, Ye T et al. The Oncogenic MicroRNA Hsa-miR-155-5p Targets the Transcription Factor ELK3 and Links It to the Hypoxia Response. PLoS One 2014-01-01 [PMID: 25401928] (Chemotaxis)

Bioinformatics

• Gene Symbol: ELK3