ELF5 Recombinant Protein Antigen

Images

 
There are currently no images for ELF5 Recombinant Protein Antigen (NBP2-57358PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ELF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF5.

Source: E. coli

Amino Acid Sequence: QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57358.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ELF5 Recombinant Protein Antigen

  • E74-like factor 5 (ets domain transcription factor)
  • E74-like factor 5
  • Epithelium-restricted ESE-1-related Ets factor
  • Epithelium-specific Ets transcription factor 2
  • ESE2ESE-2
  • ETS-related transcription factor Elf-5

Background

The protein encoded by the ELF5 gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family.In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears toregulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary glandand prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Twoalternatively spliced transcript variants encoding different isoforms have been described for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30873
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-38896
Species: Hu
Applications: IHC,  IHC-P
NB100-2136
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB (-)
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP3-04686
Species: Hu
Applications: ELISA, WB
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF6166
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
AF7619
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80695
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB

Publications for ELF5 Recombinant Protein Antigen (NBP2-57358PEP) (0)

There are no publications for ELF5 Recombinant Protein Antigen (NBP2-57358PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF5 Recombinant Protein Antigen (NBP2-57358PEP) (0)

There are no reviews for ELF5 Recombinant Protein Antigen (NBP2-57358PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ELF5 Recombinant Protein Antigen (NBP2-57358PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELF5 Products

Research Areas for ELF5 Recombinant Protein Antigen (NBP2-57358PEP)

Find related products by research area.

Blogs on ELF5

There are no specific blogs for ELF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELF5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF5