Elf4/MEF Antibody (1E10) - Azide and BSA Free

Western Blot: Elf4/MEF Antibody (1E10.) [H00002000-M02] - Detection against Immunogen (35.86 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Elf4/MEF Antibody (1E10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ELF4 (NP_001412, 521 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
• Specificity: ELF4 (1E10)
• Isotype: IgG1 Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: ELF4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Elf4/MEF Antibody (1E10) - Azide and BSA Free

• E74-like factor 4 (ets domain transcription factor)
• E74-like factor 4
• ETS-related transcription factor Elf-4
• MEFELFRMyeloid Elf-1-like factor

Background

ELF4 - E74-like factor 4 (ets domain transcription factor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELF4
• Entrez:
  • 2000(Human)
• Uniprot:
  • NP_001412(Human)