We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

eIF5A Recombinant Protein Antigen

Images

 
There are currently no images for eIF5A Recombinant Protein Antigen (NBP3-24814PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

eIF5A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human eIF5A

Source: E.coli

Amino Acid Sequence: EGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24814It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF5A Recombinant Protein Antigen

  • eIF4D
  • eIF-4D
  • eIF5A
  • EIF-5A
  • EIF5A1
  • eIF-5A1
  • eIF-5A-1
  • eIF5AI
  • Eukaryotic initiation factor 5A isoform 1
  • eukaryotic initiation factor 5A
  • eukaryotic translation initiation factor 5A
  • eukaryotic translation initiation factor 5A-1
  • MGC104255
  • MGC99547
  • Rev-binding Factor

Background

The human eukaryotic translation initiation factor 5A (eIF5A) is an 18 kDa protein. eIF5A precursor [(ec-eIF-5A(lys)] is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of the first peptide bond during the initial stage of protein synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91994
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85943
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-16866
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87094
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61656
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-92880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85808
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83164
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for eIF5A Recombinant Protein Antigen (NBP3-24814PEP) (0)

There are no publications for eIF5A Recombinant Protein Antigen (NBP3-24814PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF5A Recombinant Protein Antigen (NBP3-24814PEP) (0)

There are no reviews for eIF5A Recombinant Protein Antigen (NBP3-24814PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF5A Recombinant Protein Antigen (NBP3-24814PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF5A Products

Research Areas for eIF5A Recombinant Protein Antigen (NBP3-24814PEP)

Find related products by research area.

Blogs on eIF5A

There are no specific blogs for eIF5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our eIF5A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF5A