eIF5A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

eIF5A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human eIF5A
  
  

  Source: E.coli

  Amino Acid Sequence: EGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: EIF5A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24814It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF5A Recombinant Protein Antigen

• eIF4D
• eIF-4D
• eIF5A
• EIF-5A
• EIF5A1
• eIF-5A1
• eIF-5A-1
• eIF5AI
• Eukaryotic initiation factor 5A isoform 1
• eukaryotic initiation factor 5A
• eukaryotic translation initiation factor 5A
• eukaryotic translation initiation factor 5A-1
• MGC104255
• MGC99547
• Rev-binding Factor

Background

The human eukaryotic translation initiation factor 5A (eIF5A) is an 18 kDa protein. eIF5A precursor [(ec-eIF-5A(lys)] is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of the first peptide bond during the initial stage of protein synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF5A