eIF4ENIF1 Antibody (2C4) Summary
Immunogen |
EIF4ENIF1 (NP_062817, 886 a.a. ~ 985 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ |
Specificity |
EIF4ENIF1 - eukaryotic translation initiation factor 4E nuclear import factor 1 (2C4) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
EIF4ENIF1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
|
Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for eIF4ENIF1 Antibody (2C4)
Background
The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic;its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P, KO
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, I
Applications: WB, ELISA, ICC/IF, IHC, IP, PLA, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for eIF4ENIF1 Antibody (H00056478-M01) (0)
There are no publications for eIF4ENIF1 Antibody (H00056478-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for eIF4ENIF1 Antibody (H00056478-M01) (0)
There are no reviews for eIF4ENIF1 Antibody (H00056478-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for eIF4ENIF1 Antibody (H00056478-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional eIF4ENIF1 Products
Bioinformatics Tool for eIF4ENIF1 Antibody (H00056478-M01)
Discover related pathways, diseases and genes to eIF4ENIF1 Antibody (H00056478-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for eIF4ENIF1 Antibody (H00056478-M01)
Discover more about diseases related to eIF4ENIF1 Antibody (H00056478-M01).
| | Pathways for eIF4ENIF1 Antibody (H00056478-M01)
View related products by pathway.
|
PTMs for eIF4ENIF1 Antibody (H00056478-M01)
Learn more about PTMs related to eIF4ENIF1 Antibody (H00056478-M01).
| | Research Areas for eIF4ENIF1 Antibody (H00056478-M01)
Find related products by research area.
|
Blogs on eIF4ENIF1