eIF4ENIF1 Antibody (2C4)

Images

 
Western Blot: eIF4ENIF1 Antibody (2C4) [H00056478-M01] - Analysis of EIF4ENIF1 expression in transfected 293T cell line by EIF4ENIF1 monoclonal antibody (M01), clone 2C4.Lane 1: EIF4ENIF1 transfected lysate(108.201 ...read more
Immunocytochemistry/ Immunofluorescence: eIF4ENIF1 Antibody (2C4) [H00056478-M01] - Analysis of monoclonal antibody to EIF4ENIF1 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

eIF4ENIF1 Antibody (2C4) Summary

Immunogen
EIF4ENIF1 (NP_062817, 886 a.a. ~ 985 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
Specificity
EIF4ENIF1 - eukaryotic translation initiation factor 4E nuclear import factor 1 (2C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF4ENIF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF4ENIF1 Antibody (2C4)

  • 4E-TFLJ26551,2610509L04Rik
  • Clast4
  • eIF4E-transporter
  • eukaryotic translation initiation factor 4E nuclear import factor 1eIF4E transporter
  • eukaryotic translation initiation factor 4E transporter
  • FLJ21601

Background

The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic;its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Po
Applications: WB, IP
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46162
Species: Hu
Applications: WB, IHC
NBP2-80524
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064506-D01P
Species: Hu, Mu
Applications: WB
NBP2-81781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-66826
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00055802-M06
Species: Hu, Mu, Rt, I
Applications: WB, ELISA, ICC/IF, IHC, IP, PLA, S-ELISA
NB100-1556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, ICC
H00056478-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for eIF4ENIF1 Antibody (H00056478-M01) (0)

There are no publications for eIF4ENIF1 Antibody (H00056478-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4ENIF1 Antibody (H00056478-M01) (0)

There are no reviews for eIF4ENIF1 Antibody (H00056478-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF4ENIF1 Antibody (H00056478-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional eIF4ENIF1 Products

Bioinformatics Tool for eIF4ENIF1 Antibody (H00056478-M01)

Discover related pathways, diseases and genes to eIF4ENIF1 Antibody (H00056478-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4ENIF1 Antibody (H00056478-M01)

Discover more about diseases related to eIF4ENIF1 Antibody (H00056478-M01).
 

Pathways for eIF4ENIF1 Antibody (H00056478-M01)

View related products by pathway.

PTMs for eIF4ENIF1 Antibody (H00056478-M01)

Learn more about PTMs related to eIF4ENIF1 Antibody (H00056478-M01).
 

Research Areas for eIF4ENIF1 Antibody (H00056478-M01)

Find related products by research area.

Blogs on eIF4ENIF1

There are no specific blogs for eIF4ENIF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF4ENIF1 Antibody (2C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4ENIF1
Entrez
Uniprot