eIF4EBP2 Antibody (2G8)

Images

 
Western Blot: eIF4EBP2 Antibody (2G8) [H00001979-M04] - Detection against Immunogen (32.34 KDa)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

eIF4EBP2 Antibody (2G8) Summary

Immunogen
EIF4EBP2 (NP_004087 61 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Specificity
EIF4EBP2 - eukaryotic translation initiation factor 4E binding protein 2 (2G8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF4EBP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF4EBP2 Antibody (2G8)

  • 4EBP2
  • 4E-BP2
  • eIF4E-binding protein 2
  • eukaryotic translation initiation factor 4E binding protein 2
  • eukaryotic translation initiation factor 4E-binding protein 2
  • PHASII
  • phosphorylated, heat and acid stable regulated by insulin protein II

Background

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP1-91867
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-331
Species: Hu, Mu, Rt
Applications: IP (-), WB
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008569-M14
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP2-46403
Species: Hu
Applications: IHC

Publications for eIF4EBP2 Antibody (H00001979-M04) (0)

There are no publications for eIF4EBP2 Antibody (H00001979-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4EBP2 Antibody (H00001979-M04) (0)

There are no reviews for eIF4EBP2 Antibody (H00001979-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF4EBP2 Antibody (H00001979-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF4EBP2 Products

Bioinformatics Tool for eIF4EBP2 Antibody (H00001979-M04)

Discover related pathways, diseases and genes to eIF4EBP2 Antibody (H00001979-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4EBP2 Antibody (H00001979-M04)

Discover more about diseases related to eIF4EBP2 Antibody (H00001979-M04).
 

Pathways for eIF4EBP2 Antibody (H00001979-M04)

View related products by pathway.

PTMs for eIF4EBP2 Antibody (H00001979-M04)

Learn more about PTMs related to eIF4EBP2 Antibody (H00001979-M04).
 

Research Areas for eIF4EBP2 Antibody (H00001979-M04)

Find related products by research area.

Blogs on eIF4EBP2

There are no specific blogs for eIF4EBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF4EBP2 Antibody (2G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4EBP2
Entrez
Uniprot