eIF4EBP2 Antibody (2G8) - Azide and BSA Free

Western Blot: eIF4EBP2 Antibody (2G8) [H00001979-M04] - Detection against Immunogen (32.34 KDa)

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

eIF4EBP2 Antibody (2G8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EIF4EBP2 (NP_004087, 61 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
• Specificity: EIF4EBP2 - eukaryotic translation initiation factor 4E binding protein 2 (2G8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EIF4EBP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF4EBP2 Antibody (2G8) - Azide and BSA Free

• 4EBP2
• 4E-BP2
• eIF4E-binding protein 2
• eukaryotic translation initiation factor 4E binding protein 2
• eukaryotic translation initiation factor 4E-binding protein 2
• PHASII
• phosphorylated, heat and acid stable regulated by insulin protein II

Background

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF4EBP2
• Entrez:
  • 1979(Human)
• Uniprot:
  • NP_004087(Human)