eIF3K Antibody - BSA Free

Western Blot: eIF3K Antibody [NBP1-91865] - Analysis using Anti-EIF3K antibody NBP1-91865 (A) shows similar pattern to independent antibody NBP2-56764 (B).

Immunohistochemistry-Paraffin: eIF3K Antibody [NBP1-91865] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

eIF3K Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF3K
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  eIF3K Protein (NBP1-91865PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for eIF3K Antibody - BSA Free

• ARG134
• eIF3k
• EIF3-p28
• EIF3S12eIF-3 p28
• Eukaryotic translation initiation factor 3 subunit 12
• eukaryotic translation initiation factor 3 subunit K
• eukaryotic translation initiation factor 3, subunit 12
• eukaryotic translation initiation factor 3, subunit K
• HSPC029
• M9
• MSTP001
• muscle specific
• Muscle-specific gene M9 protein
• PLAC24
• PLAC-24
• PLAC-24eIF-3 p25
• PRO1474
• PTD001

Background

The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF3K
• Entrez:
  • 27335(Human)
• Uniprot:
  • Q9UBQ5(Human)