eIF3e Recombinant Protein Antigen

Images

 
There are currently no images for eIF3e Protein (NBP1-84869PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

eIF3e Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3E.

Source: E.coli

Amino Acid Sequence: ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF3E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84869.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for eIF3e Recombinant Protein Antigen

  • eIF-3 p48
  • eIF3e
  • eIF3-p48
  • EIF3S6EIF3-P48
  • Eukaryotic translation initiation factor 3 subunit 6
  • eukaryotic translation initiation factor 3 subunit E
  • eukaryotic translation initiation factor 3, subunit 6 (48kD)
  • eukaryotic translation initiation factor 3, subunit 6 48kDa
  • eukaryotic translation initiation factor 3, subunit E
  • INT6eIF3-p46
  • mammary tumor-associated protein INT6
  • murine mammary tumor integration site 6 (oncogene homolog)
  • Viral integration site protein INT-6 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
H00010379-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-47427
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP
NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-16299
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Re, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PAGE, Dual ISH-IHC, KD, KO
NBP2-24468
Species: Hu, Mu, Rt, Pm, Ze
Applications: WB
NB100-268
Species: Hu, Po
Applications: WB, IP
NB100-368
Species: Hu, Mu
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84869PEP
Species: Hu
Applications: AC

Publications for eIF3e Protein (NBP1-84869PEP) (0)

There are no publications for eIF3e Protein (NBP1-84869PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF3e Protein (NBP1-84869PEP) (0)

There are no reviews for eIF3e Protein (NBP1-84869PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF3e Protein (NBP1-84869PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional eIF3e Products

Bioinformatics Tool for eIF3e Protein (NBP1-84869PEP)

Discover related pathways, diseases and genes to eIF3e Protein (NBP1-84869PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF3e Protein (NBP1-84869PEP)

Discover more about diseases related to eIF3e Protein (NBP1-84869PEP).
 

Pathways for eIF3e Protein (NBP1-84869PEP)

View related products by pathway.

PTMs for eIF3e Protein (NBP1-84869PEP)

Learn more about PTMs related to eIF3e Protein (NBP1-84869PEP).

Blogs on eIF3e

There are no specific blogs for eIF3e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our eIF3e Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3E