EIF3B Recombinant Protein Antigen

Images

 
There are currently no images for EIF3B Protein (NBP2-38597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EIF3B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3B.

Source: E.coli

Amino Acid Sequence: PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF3B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38597.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for EIF3B Recombinant Protein Antigen

  • eIF3 p110
  • eIF3 p116
  • eIF3b
  • eIF-3-eta
  • EIF3-P110
  • EIF3-P116
  • EIF3S9EIF3-ETA
  • Eukaryotic translation initiation factor 3 subunit 9
  • eukaryotic translation initiation factor 3 subunit B
  • eukaryotic translation initiation factor 3, subunit 9 (eta, 116kD)
  • eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa
  • eukaryotic translation initiation factor 3, subunit B
  • MGC104664
  • MGC131875
  • Prt1 homolog
  • PRT1hPrt1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54692
Species: Hu
Applications: WB, IHC, IHC-P
NB300-130
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92345
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EIF3B Protein (NBP2-38597PEP) (0)

There are no publications for EIF3B Protein (NBP2-38597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3B Protein (NBP2-38597PEP) (0)

There are no reviews for EIF3B Protein (NBP2-38597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for EIF3B Protein (NBP2-38597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for EIF3B Protein (NBP2-38597PEP)

Discover related pathways, diseases and genes to EIF3B Protein (NBP2-38597PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3B Protein (NBP2-38597PEP)

Discover more about diseases related to EIF3B Protein (NBP2-38597PEP).
 

Pathways for EIF3B Protein (NBP2-38597PEP)

View related products by pathway.

PTMs for EIF3B Protein (NBP2-38597PEP)

Learn more about PTMs related to EIF3B Protein (NBP2-38597PEP).

Blogs on EIF3B

There are no specific blogs for EIF3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EIF3B Antibody
NBP2-24571
Ubiquitin
U-100H-10M

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EIF3B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3B