EIF2 beta Recombinant Protein Antigen

Images

 
There are currently no images for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EIF2 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF2 beta.

Source: E. coli

Amino Acid Sequence: KIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF2S2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58948. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EIF2 beta Recombinant Protein Antigen

  • DKFZp686L18198
  • EIF2
  • EIF2B
  • EIF2beta
  • eIF-2-beta
  • eukaryotic initiation factor 2-beta
  • eukaryotic translation initiation factor 2 beta
  • eukaryotic translation initiation factor 2 subunit 2
  • Eukaryotic translation initiation factor 2 subunit beta
  • eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • MGC8508

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16674
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-61762
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-03605
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP2-58948PEP
Species: Hu
Applications: AC

Publications for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP) (0)

There are no publications for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP) (0)

There are no reviews for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF2 beta Products

Research Areas for EIF2 beta Recombinant Protein Antigen (NBP2-58948PEP)

Find related products by research area.

Blogs on EIF2 beta

There are no specific blogs for EIF2 beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EIF2 beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S2