Recombinant Human EGLN1/PHD2 Protein

Images

 
Recombinant Human EGLN1/PHD2 Protein [H00054583-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EGLN1/PHD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-128 of Human EGLN1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
EGLN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
H00054583-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EGLN1/PHD2 Protein

  • C1orf12
  • C1orf12HPH2
  • EC 1.14.11
  • EC 1.14.11.-
  • ECYT3
  • egl nine homolog 1 (C. elegans)
  • egl nine homolog 1
  • egl nine-like protein 1
  • EGLN1
  • HIF prolyl hydroxylase 2
  • HIFPH2 EGL nine (C.elegans) homolog 1
  • HIFPH2
  • HIF-PH2
  • HIF-prolyl hydroxylase 2
  • HPH2
  • HPH-2
  • Hypoxia-inducible factor prolyl hydroxylase 2
  • PHD2
  • PHD2SM20
  • Prolyl hydroxylase domain-containing protein 2
  • SM20
  • SM-20
  • zinc finger MYND domain-containing protein 6
  • ZMYND6
  • ZMYND6DKFZp761F179

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
NB100-139
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP
AF6394
Species: Hu
Applications: WB, IP
NB100-485
Species: Hu
Applications: WB, IP
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE, KO
NB100-77334
Species: Hu
Applications: WB, Flow, PEP-ELISA, KD
NB100-428
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP
NBP2-32844
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PAGE
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054583-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for EGLN1/PHD2 Recombinant Protein (H00054583-P01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: EnzAct, In vitro.


Filter By Application
EnzAct
(1)
In vitro
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for EGLN1/PHD2 Recombinant Protein (H00054583-P01) (0)

There are no reviews for EGLN1/PHD2 Recombinant Protein (H00054583-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EGLN1/PHD2 Recombinant Protein (H00054583-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional EGLN1/PHD2 Products

Bioinformatics Tool for EGLN1/PHD2 Recombinant Protein (H00054583-P01)

Discover related pathways, diseases and genes to EGLN1/PHD2 Recombinant Protein (H00054583-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGLN1/PHD2 Recombinant Protein (H00054583-P01)

Discover more about diseases related to EGLN1/PHD2 Recombinant Protein (H00054583-P01).
 

Pathways for EGLN1/PHD2 Recombinant Protein (H00054583-P01)

View related products by pathway.

PTMs for EGLN1/PHD2 Recombinant Protein (H00054583-P01)

Learn more about PTMs related to EGLN1/PHD2 Recombinant Protein (H00054583-P01).
 

Research Areas for EGLN1/PHD2 Recombinant Protein (H00054583-P01)

Find related products by research area.

Blogs on EGLN1/PHD2

There are no specific blogs for EGLN1/PHD2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EGLN1/PHD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EGLN1