EGF-L6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

EGF-L6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EGFL6.
  
  

  Source: E. coli

  Amino Acid Sequence: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: EGFL6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33282.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EGF-L6 Recombinant Protein Antigen

• DKFZp564P2063
• EGF repeat-containing protein 6
• EGFL6
• EGF-L6
• EGF-like protein 6
• EGF-like-domain, multiple 6
• epidermal growth factor-like protein 6
• MAEG
• MAM and EGF domain containing
• MAM and EGF domains-containing gene protein
• W80

Background

The EGFL6 gene encodes an epidermal growth factor-like protein 6 with isoform 1 having 553 amino acids in length at 61 kDA and isoform 2 at 554 amino acids in length at 61 kDA. Member sof the epidermal growth factor (EGF) repeat family are known to be involved in the regulation of cell cycle, proliferation, and developmental processes. This protein encourages matrix assembly and aids in binding integrin alpha-8/beta-1, playing a role in hair follicle morphogenesis and is known to interact with genes SH3GL3 and SH3GL2. EGFL6 has been linked to detrusor sphincter dyssynergia, benign meningioma, bladder diverticulum, lung meningioma, and obesity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: EGFL6