We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

EGF-L6 Recombinant Protein Antigen

Images

 
There are currently no images for EGF-L6 Protein (NBP2-33282PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EGF-L6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EGFL6.

Source: E. coli

Amino Acid Sequence: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EGFL6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33282.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EGF-L6 Recombinant Protein Antigen

  • DKFZp564P2063
  • EGF repeat-containing protein 6
  • EGFL6
  • EGF-L6
  • EGF-like protein 6
  • EGF-like-domain, multiple 6
  • epidermal growth factor-like protein 6
  • MAEG
  • MAM and EGF domain containing
  • MAM and EGF domains-containing gene protein
  • W80

Background

The EGFL6 gene encodes an epidermal growth factor-like protein 6 with isoform 1 having 553 amino acids in length at 61 kDA and isoform 2 at 554 amino acids in length at 61 kDA. Member sof the epidermal growth factor (EGF) repeat family are known to be involved in the regulation of cell cycle, proliferation, and developmental processes. This protein encourages matrix assembly and aids in binding integrin alpha-8/beta-1, playing a role in hair follicle morphogenesis and is known to interact with genes SH3GL3 and SH3GL2. EGFL6 has been linked to detrusor sphincter dyssynergia, benign meningioma, bladder diverticulum, lung meningioma, and obesity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

236-EG
Species: Hu
Applications: BA
DAN00
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
NBP1-52012
Species: Ca, Hu, Po
Applications: IHC,  IHC-P, PEP-ELISA, WB
4298-NP
Species: Mu
Applications: BA
AF2397
Species: Hu
Applications: WB
AF751
Species: Hu
Applications: WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
AF144
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
538-MG
Species: Rt
Applications: BA
DTM100
Species: Hu
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
MAB4675
Species: Mu
Applications: IHC, Neut, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
M6000B
Species: Mu
Applications: ELISA

Publications for EGF-L6 Protein (NBP2-33282PEP) (0)

There are no publications for EGF-L6 Protein (NBP2-33282PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGF-L6 Protein (NBP2-33282PEP) (0)

There are no reviews for EGF-L6 Protein (NBP2-33282PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EGF-L6 Protein (NBP2-33282PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGF-L6 Products

Research Areas for EGF-L6 Protein (NBP2-33282PEP)

Find related products by research area.

Blogs on EGF-L6

There are no specific blogs for EGF-L6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EGF-L6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EGFL6