EFTUD1 Antibody

Images

 
Immunohistochemistry: EFTUD1 Antibody [NBP2-32619] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EFTUD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SDLIRSMEQLTSSLNEGENTHMIHQKTQEKIWEFKGKLEQHLTGRRWRNIVDQIWSFGPRKCGPNILVNKSEDFQNSVWTGPADKASKEASRYRDLGNSIVSGFQLATL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EFTUD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EFTUD1 Protein (NBP2-32619PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EFTUD1 Antibody

  • EFL1
  • Elongation Factor Tu GTP Binding Domain Containing 1
  • Elongation Factor Tu GTP-Binding Domain-Containing Protein 1
  • Elongation Factor-Like 1
  • FAM42A
  • HsT19294
  • Protein FAM42A
  • RIA1
  • Ribosome Assembly 1 Homolog (Yeast)
  • Ribosome Assembly 1 Homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85646
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-98594
Species: Hu
Applications: WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40318
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-55058
Species: Hu
Applications: WB, ICC/IF
NBP2-46466
Species: Hu
Applications: IHC
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for EFTUD1 Antibody (NBP2-32619) (0)

There are no publications for EFTUD1 Antibody (NBP2-32619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFTUD1 Antibody (NBP2-32619) (0)

There are no reviews for EFTUD1 Antibody (NBP2-32619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EFTUD1 Antibody (NBP2-32619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EFTUD1 Products

Bioinformatics Tool for EFTUD1 Antibody (NBP2-32619)

Discover related pathways, diseases and genes to EFTUD1 Antibody (NBP2-32619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFTUD1 Antibody (NBP2-32619)

Discover more about diseases related to EFTUD1 Antibody (NBP2-32619).

Blogs on EFTUD1

There are no specific blogs for EFTUD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFTUD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFTUD1