EEF1B2 Antibody


Western Blot: EEF1B2 Antibody [NBP1-53035] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EEF1B2 Antibody Summary

Synthetic peptides corresponding to EEF1B2(eukaryotic translation elongation factor 1 beta 2) The peptide sequence was selected from the middle region of EEF1B2 (NP_066944). Peptide sequence VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
Band seen at ~32 kDa in Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
EEF1B2 Lysate (NBP2-66024)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EEF1B2 Antibody

  • EEF1B
  • EEF1B1
  • EF1B
  • EF-1-beta
  • elongation factor 1-beta
  • eukaryotic translation elongation factor 1 beta 1
  • eukaryotic translation elongation factor 1 beta 2


EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB

Publications for EEF1B2 Antibody (NBP1-53035) (0)

There are no publications for EEF1B2 Antibody (NBP1-53035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEF1B2 Antibody (NBP1-53035) (0)

There are no reviews for EEF1B2 Antibody (NBP1-53035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EEF1B2 Antibody (NBP1-53035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional EEF1B2 Products

Bioinformatics Tool for EEF1B2 Antibody (NBP1-53035)

Discover related pathways, diseases and genes to EEF1B2 Antibody (NBP1-53035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEF1B2 Antibody (NBP1-53035)

Discover more about diseases related to EEF1B2 Antibody (NBP1-53035).

Pathways for EEF1B2 Antibody (NBP1-53035)

View related products by pathway.

Blogs on EEF1B2

There are no specific blogs for EEF1B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EEF1B2 Antibody and receive a gift card or discount.


Gene Symbol EEF1B2