eEF1A2 binding protein Antibody (5B12) - Azide and BSA Free

Western Blot: eEF1A2 binding protein Antibody (5B12) [H00091156-M01] - DKFZp434B1231 monoclonal antibody (M01), clone 5B12 Analysis of DKFZp434B1231 expression in A-431.

Immunocytochemistry/Immunofluorescence: eEF1A2 binding protein Antibody (5B12) [H00091156-M01] - Analysis of monoclonal antibody to DKFZp434B1231 on HeLa cell. Antibody concentration 15 ug/ml.

Sandwich ELISA: eEF1A2 binding protein Antibody (5B12) [H00091156-M01] - Detection limit for recombinant GST tagged DKFZp434B1231 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 5B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

eEF1A2 binding protein Antibody (5B12) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse eEF1A2 binding protein Antibody (5B12) - Azide and BSA Free (H00091156-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DKFZp434B1231 (NP_840059, 720 a.a. ~ 818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP
• Specificity: DKFZp434B1231 - eEF1A2 binding protein
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IGFN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eEF1A2 binding protein Antibody (5B12) - Azide and BSA Free

• DKFZp434B1231
• eEF1A2 binding protein
• EEF1A2-binding protein 1
• EEF1A2BP1
• immunoglobulin-like and fibronectin type III domain containing 1
• immunoglobulin-like and fibronectin type III domain-containing protein 1
• KY-interacting protein 1
• KYIP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGFN1
• Entrez:
  • 91156(Human)