Recombinant Human EDC4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EDC4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1302-1401 of Human RCD-8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EDC4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EDC4 Protein

  • Autoantigen Ge-1
  • Autoantigen RCD-8
  • enhancer of mRNA decapping 4
  • enhancer of mRNA-decapping protein 4
  • Ge-1
  • Hedls
  • HEDLSHuman enhancer of decapping large subunit
  • RCD-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-41070
Species: Hu
Applications: WB, IP, PLA
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-88473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-83680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30473
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EDC4 Partial Recombinant Protein (H00023644-Q01) (0)

There are no publications for EDC4 Partial Recombinant Protein (H00023644-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDC4 Partial Recombinant Protein (H00023644-Q01) (0)

There are no reviews for EDC4 Partial Recombinant Protein (H00023644-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDC4 Partial Recombinant Protein (H00023644-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDC4 Products

Bioinformatics Tool for EDC4 Partial Recombinant Protein (H00023644-Q01)

Discover related pathways, diseases and genes to EDC4 Partial Recombinant Protein (H00023644-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDC4 Partial Recombinant Protein (H00023644-Q01)

Discover more about diseases related to EDC4 Partial Recombinant Protein (H00023644-Q01).
 

Pathways for EDC4 Partial Recombinant Protein (H00023644-Q01)

View related products by pathway.

PTMs for EDC4 Partial Recombinant Protein (H00023644-Q01)

Learn more about PTMs related to EDC4 Partial Recombinant Protein (H00023644-Q01).
 

Research Areas for EDC4 Partial Recombinant Protein (H00023644-Q01)

Find related products by research area.

Blogs on EDC4

There are no specific blogs for EDC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EDC4 Antibody
NBP2-16267
DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EDC4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EDC4