Recombinant Human EDC4 Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human EDC4 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1302-1401 of Human EDC4
  
  

  Source: Wheat Germ

  Amino Acid Sequence: PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: EDC4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Application Notes: This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EDC4 Protein

• Autoantigen Ge-1
• Autoantigen RCD-8
• enhancer of mRNA decapping 4
• enhancer of mRNA-decapping protein 4
• Ge-1
• Hedls
• HEDLSHuman enhancer of decapping large subunit
• RCD-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: EDC4