EDC3 Antibody

Images

 
Immunohistochemistry: EDC3 Antibody [NBP2-30696] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EDC3 Protein (NBP2-30696PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EDC3 Antibody

  • enhancer of mRNA decapping 3 homolog (S. cerevisiae)
  • enhancer of mRNA-decapping protein 3
  • FLJ21128
  • FLJ31777
  • hYjeF_N2
  • hYjeF_N2-15q23
  • LSM16 homolog (EDC3, S. cerevisiae)
  • LSM16 homolog
  • LSM16
  • YJDC
  • yjeF domain containing
  • YjeF domain-containing protein 1
  • YjeF N-terminal domain-containing protein 2
  • yjeF_N2
  • YJEFN2yjeF domain containing (E.coli)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16109
Species: Hu, Mu, Ze
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89390
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30696
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for EDC3 Antibody (NBP2-30696) (0)

There are no publications for EDC3 Antibody (NBP2-30696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDC3 Antibody (NBP2-30696) (0)

There are no reviews for EDC3 Antibody (NBP2-30696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EDC3 Antibody (NBP2-30696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EDC3 Products

Bioinformatics Tool for EDC3 Antibody (NBP2-30696)

Discover related pathways, diseases and genes to EDC3 Antibody (NBP2-30696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDC3 Antibody (NBP2-30696)

Discover more about diseases related to EDC3 Antibody (NBP2-30696).
 

Pathways for EDC3 Antibody (NBP2-30696)

View related products by pathway.

PTMs for EDC3 Antibody (NBP2-30696)

Learn more about PTMs related to EDC3 Antibody (NBP2-30696).

Blogs on EDC3

There are no specific blogs for EDC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDC3
Uniprot