EDC3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL |
| Predicted Species |
Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EDC3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EDC3 Antibody - BSA Free
Background
EDC3, also known as Enhancer of mRNA-decapping protein 3, is a 508 amino acid that is 56 kDa, located in the cytoplasm and expressed in theca and granulosa cells in ovary, Sertoli cells in testis (at protein level), brain and mammary glands; may play a role in mRNA decapping in the process of mRNA degradation, and also in spermiogenesis and oogenesis. Disease research is currently being studied with relation to central nervous system origin vertigo, patellofemoral pain syndrome and hordeolum. Interactions with the EDC3 protein have been shown to involve YWHAG, YWHAB, ZFP36, SFN, DDX6, YWHAZ, DCP2, UPF1, DCP1B and KBTBD7 in n exonucleolytic nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, gene expression, and mRNA metabolic process pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for EDC3 Antibody (NBP2-30696) (0)
There are no publications for EDC3 Antibody (NBP2-30696).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EDC3 Antibody (NBP2-30696) (0)
There are no reviews for EDC3 Antibody (NBP2-30696).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for EDC3 Antibody (NBP2-30696) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EDC3 Products
Blogs on EDC3