APOA1BP Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL |
| Predicted Species |
Mouse (94%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NAXE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Knockdown Validated
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for APOA1BP Antibody - BSA Free
Background
The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, Mycoplasma
Publications for APOA1BP Antibody (NBP2-30626)(2)
Showing Publications 1 -
2 of 2.
| Publications using NBP2-30626 |
Applications |
Species |
| Jiang Y, Li X, Liu Q et al. Apolipoprotein A-I binding protein inhibits the formation of infantile hemangioma via cholesterol-regulated Hif1? activation The Journal of investigative dermatology 2023-10-11 [PMID: 37832842] |
|
|
| Soo-Ho Choi, Keun-Young Kim, Guy A. Perkins, Sébastien Phan, Genea Edwards, Yining Xia, Jungsu Kim, Dorota Skowronska-Krawczyk, Robert N. Weinreb, Mark H. Ellisman, Yury I. Miller, Won-Kyu Ju AIBP protects retinal ganglion cells against neuroinflammation and mitochondrial dysfunction in glaucomatous neurodegeneration Redox Biology 2020-08-27 [PMID: 32896719] |
|
|
Reviews for APOA1BP Antibody (NBP2-30626) (0)
There are no reviews for APOA1BP Antibody (NBP2-30626).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for APOA1BP Antibody (NBP2-30626) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional APOA1BP Products
Research Areas for APOA1BP Antibody (NBP2-30626)
Find related products by research area.
|
Blogs on APOA1BP