APOA1BP Antibody - BSA Free

Western Blot: APOA1BP Antibody [NBP2-30626] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-NAXE antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NAXE antibody NBP2-30626 (A) shows similar protein distribution across tissues to independent antibody NBP2-30943 (B).

Immunocytochemistry/Immunofluorescence: APOA1BP Antibody [NBP2-30626] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human kidney.

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human testis.

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30626] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APOA1BP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAXE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  APOA1BP Protein (NBP2-30626PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APOA1BP Antibody - BSA Free

• AIBPAI-BP
• apolipoprotein A-I binding protein
• apolipoprotein A-I-binding protein
• MGC119143
• MGC119144
• MGC119145
• YjeF N-terminal domain-containing protein 1
• yjeF_N1
• YJEFN1apoA-I binding protein

Background

The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APOA1BP Antibody (NBP2-30626)(2)

Publications using NBP2-30626

• Jiang Y, Li X, Liu Q et al. Apolipoprotein A-I binding protein inhibits the formation of infantile hemangioma via cholesterol-regulated Hif1? activation The Journal of investigative dermatology 2023-10-11 [PMID: 37832842]
• Soo-Ho Choi, Keun-Young Kim, Guy A. Perkins, Sébastien Phan, Genea Edwards, Yining Xia, Jungsu Kim, Dorota Skowronska-Krawczyk, Robert N. Weinreb, Mark H. Ellisman, Yury I. Miller, Won-Kyu Ju AIBP protects retinal ganglion cells against neuroinflammation and mitochondrial dysfunction in glaucomatous neurodegeneration Redox Biology 2020-08-27 [PMID: 32896719]

Bioinformatics

• Gene Symbol: NAXE
• Uniprot:
  • Q8NCW5(Human)