ECSIT Antibody

Images

 
Western Blot: ECSIT Antibody [NBP2-87320] - WB Suggested Anti-Ecsit Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Heart

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECSIT Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse ECSIT. Peptide sequence: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ECSIT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECSIT Antibody

  • ECSIT homolog (Drosophila)
  • evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
  • likely ortholog of mouse signaling intermediate in Toll pathway evolutionarilyconserved
  • Protein SITPEC
  • signaling intermediate in Toll pathway evolutionarily conserved ortholog
  • SITPECsignaling intermediate in Toll pathway, evolutionarily conserved

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, PAGE, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-80468
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-47810
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-24951
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-82749
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF7618
Species: Hu
Applications: WB
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59337
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00004891-M01
Species: Hu, Mu, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-87320
Species: Mu
Applications: WB

Publications for ECSIT Antibody (NBP2-87320) (0)

There are no publications for ECSIT Antibody (NBP2-87320).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECSIT Antibody (NBP2-87320) (0)

There are no reviews for ECSIT Antibody (NBP2-87320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ECSIT Antibody (NBP2-87320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ECSIT Products

Array NBP2-87320

Bioinformatics Tool for ECSIT Antibody (NBP2-87320)

Discover related pathways, diseases and genes to ECSIT Antibody (NBP2-87320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECSIT Antibody (NBP2-87320)

Discover more about diseases related to ECSIT Antibody (NBP2-87320).
 

Pathways for ECSIT Antibody (NBP2-87320)

View related products by pathway.

PTMs for ECSIT Antibody (NBP2-87320)

Learn more about PTMs related to ECSIT Antibody (NBP2-87320).
 

Research Areas for ECSIT Antibody (NBP2-87320)

Find related products by research area.

Blogs on ECSIT

There are no specific blogs for ECSIT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECSIT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECSIT