ECM2 Antibody

Images

 
Immunohistochemistry-Paraffin: ECM2 Antibody [NBP1-91004] - Staining of human breast shows strong cytoplasmic positivity in adipocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ECM2 Protein (NBP1-91004PEP)
Publications
Read Publication using NBP1-91004.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECM2 Antibody

  • ECM2
  • extracellular matrix protein 2
  • extracellular matrix protein 2, female organ and adipocyte specific
  • Matrix Glycoprotein SC1
  • MGC126356

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF8218
Species: Hu
Applications: WB, IHC
AF981
Species: Hu
Applications: WB, IHC, ICC, Neut
AF3308
Species: Mu
Applications: WB
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PEP-ELISA, ICC
NBP2-13881
Species: Hu
Applications: WB, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-91004
Species: Hu
Applications: IHC, IHC-P

Publications for ECM2 Antibody (NBP1-91004)(1)

Reviews for ECM2 Antibody (NBP1-91004) (0)

There are no reviews for ECM2 Antibody (NBP1-91004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ECM2 Antibody (NBP1-91004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECM2 Products

Bioinformatics Tool for ECM2 Antibody (NBP1-91004)

Discover related pathways, diseases and genes to ECM2 Antibody (NBP1-91004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECM2 Antibody (NBP1-91004)

Discover more about diseases related to ECM2 Antibody (NBP1-91004).
 

Pathways for ECM2 Antibody (NBP1-91004)

View related products by pathway.

Blogs on ECM2

There are no specific blogs for ECM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECM2
Entrez