ECM-1/Secretory Component P85 Antibody

Images

 
Immunohistochemistry: ECM-1/Secretory Component P85 Antibody [NBP1-87449] - Immunohistochemical staining of human vagina shows strong cytoplasmic positivity in subset of squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECM-1/Secretory Component P85 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ECM-1/Secretory Component P85 Protein (NBP1-87449PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECM-1/Secretory Component P85 Antibody

  • ECM1
  • extracellular matrix protein 1
  • p85
  • Secretory Component Glycoprotein
  • Secretory Component P85

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF6235
Species: Hu
Applications: WB
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB6777
Species: Hu
Applications: WB, ICC
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4875
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-13659
Species: Hu
Applications: IHC, IHC-P
NBP1-56991
Species: Hu
Applications: WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS

Publications for ECM-1/Secretory Component P85 Antibody (NBP1-87449) (0)

There are no publications for ECM-1/Secretory Component P85 Antibody (NBP1-87449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECM-1/Secretory Component P85 Antibody (NBP1-87449) (0)

There are no reviews for ECM-1/Secretory Component P85 Antibody (NBP1-87449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ECM-1/Secretory Component P85 Antibody (NBP1-87449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECM-1/Secretory Component P85 Products

Bioinformatics Tool for ECM-1/Secretory Component P85 Antibody (NBP1-87449)

Discover related pathways, diseases and genes to ECM-1/Secretory Component P85 Antibody (NBP1-87449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECM-1/Secretory Component P85 Antibody (NBP1-87449)

Discover more about diseases related to ECM-1/Secretory Component P85 Antibody (NBP1-87449).
 

Pathways for ECM-1/Secretory Component P85 Antibody (NBP1-87449)

View related products by pathway.

PTMs for ECM-1/Secretory Component P85 Antibody (NBP1-87449)

Learn more about PTMs related to ECM-1/Secretory Component P85 Antibody (NBP1-87449).

Blogs on ECM-1/Secretory Component P85

There are no specific blogs for ECM-1/Secretory Component P85, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECM-1/Secretory Component P85 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECM1
Entrez