ECH1 Antibody

Images

 
Western Blot: ECH1 Antibody [NBP1-54738] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECH1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ECH1(enoyl Coenzyme A hydratase 1, peroxisomal) The peptide sequence was selected from the N terminal of ECH1. Peptide sequence PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECH1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ECH1 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ECH1 Antibody

  • delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
  • delta3,5-delta2,4-dienoyl-CoA isomerase
  • dienoyl-CoA isomerase
  • EC 5.3.3.-
  • enoyl CoA hydratase 1, peroxisomal
  • enoyl Coenzyme A hydratase 1, peroxisomal
  • HPXEL
  • peroxisomal enoyl-CoA hydratase 1

Background

ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24669
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
NBP1-87078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP1-02417
Species: Hu, Mu, Rt, Av, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ECH1 Antibody (NBP1-54738) (0)

There are no publications for ECH1 Antibody (NBP1-54738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECH1 Antibody (NBP1-54738) (0)

There are no reviews for ECH1 Antibody (NBP1-54738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ECH1 Antibody (NBP1-54738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECH1 Products

Bioinformatics Tool for ECH1 Antibody (NBP1-54738)

Discover related pathways, diseases and genes to ECH1 Antibody (NBP1-54738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECH1 Antibody (NBP1-54738)

Discover more about diseases related to ECH1 Antibody (NBP1-54738).
 

Pathways for ECH1 Antibody (NBP1-54738)

View related products by pathway.

PTMs for ECH1 Antibody (NBP1-54738)

Learn more about PTMs related to ECH1 Antibody (NBP1-54738).
 

Research Areas for ECH1 Antibody (NBP1-54738)

Find related products by research area.

Blogs on ECH1

There are no specific blogs for ECH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECH1
Uniprot