EBP Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to EBP(emopamil binding protein (sterol isomerase)) The peptide sequence was selected from the N terminal of EBP. Peptide sequence LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EBP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for EBP Antibody - BSA Free
Background
EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in EBP gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome).Emopamil-binding protein (EBP) is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. EBP shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of EBP is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Mu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for EBP Antibody (NBP1-59782) (0)
There are no publications for EBP Antibody (NBP1-59782).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EBP Antibody (NBP1-59782) (0)
There are no reviews for EBP Antibody (NBP1-59782).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EBP Antibody (NBP1-59782) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EBP Products
Research Areas for EBP Antibody (NBP1-59782)
Find related products by research area.
|
Blogs on EBP