EB2 Antibody

Images

 
Western Blot: EB2 Antibody [NBP1-84927] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Staining of human colon shows strong positivity in ganglion cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPRE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EB2 Protein (NBP1-84927PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EB2 Antibody

  • APC-binding protein EB2
  • EB1
  • EB2APC-binding protein EB1
  • End-binding protein 2
  • microtubule-associated protein, RP/EB family, member 2
  • RP1microtubule-associated protein RP/EB family member 2
  • T-cell activation protein, EB1 family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
NBP1-80698
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for EB2 Antibody (NBP1-84927) (0)

There are no publications for EB2 Antibody (NBP1-84927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EB2 Antibody (NBP1-84927) (0)

There are no reviews for EB2 Antibody (NBP1-84927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EB2 Antibody (NBP1-84927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EB2 Products

Bioinformatics Tool for EB2 Antibody (NBP1-84927)

Discover related pathways, diseases and genes to EB2 Antibody (NBP1-84927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EB2 Antibody (NBP1-84927)

Discover more about diseases related to EB2 Antibody (NBP1-84927).
 

Pathways for EB2 Antibody (NBP1-84927)

View related products by pathway.

Blogs on EB2

There are no specific blogs for EB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPRE2