EB2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQ |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAPRE2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50-1:200
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EB2 Antibody - BSA Free
Background
EB2 is encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Publications for EB2 Antibody (NBP1-84927) (0)
There are no publications for EB2 Antibody (NBP1-84927).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EB2 Antibody (NBP1-84927) (0)
There are no reviews for EB2 Antibody (NBP1-84927).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EB2 Antibody (NBP1-84927) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EB2 Products
Research Areas for EB2 Antibody (NBP1-84927)
Find related products by research area.
|
Blogs on EB2