E2F-1 Antibody - BSA Free

Western Blot: E2F-1 Antibody [NBP2-56716] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: E2F-1 Antibody [NBP2-56716] - Staining of human cell line RH-30 shows localization to centrosome.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

E2F-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: E2F1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  E2F-1 Recombinant Protein Antigen (NBP2-56716PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for E2F-1 Antibody - BSA Free

• E2F transcription factor 1
• E2F1
• E2F-1
• PBR3
• PRB-binding protein E2F-1
• RBAP1
• RBAP-1
• RBBP3
• RBBP-3
• RBP3
• Retinoblastoma-associated protein 1
• Retinoblastoma-binding protein 3
• transcription factor E2F1

Background

E2F1 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for E2F-1 Antibody (NBP2-56716)(1)

Publication using NBP2-56716

• S Li, TC Jakobs Secreted phosphoprotein 1 slows neurodegeneration and rescues visual function in mouse models of aging and glaucoma Cell Reports, 2022-12-27;41(13):111880. 2022-12-27 [PMID: 36577373]

Bioinformatics

• Gene Symbol: E2F1