E2F-1 Antibody (5Z5U3)

Western Blot: E2F-1 Antibody (5Z5U3) [NBP3-15785] - Western blot analysis of extracts of rat spleen, using E2F-1 antibody (NBP3-15785) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

Western Blot: E2F-1 Antibody (5Z5U3) [NBP3-15785] - Western blot analysis of extracts of various cell lines, using E2F-1 antibody (NBP3-15785) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: E2F-1 Antibody (5Z5U3) [NBP3-15785] - Immunoprecipitation analysis of 300ug extracts of HT-29 cells using 3ug E2F-1 antibody (NBP3-15785). Western blot was performed from the immunoprecipitate using E2F-1 antibody (NBP3-15785) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP
• Clone: 5Z5U3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

E2F-1 Antibody (5Z5U3) Summary

• Description: Novus Biologicals Rabbit E2F-1 Antibody (5Z5U3) (NBP3-15785) is a recombinant monoclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F-1 (Q01094). PPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: E2F1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:50 - 1:100
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for E2F-1 Antibody (5Z5U3)

• E2F transcription factor 1
• E2F1
• E2F-1
• PBR3
• PRB-binding protein E2F-1
• RBAP1
• RBAP-1
• RBBP3
• RBBP-3
• RBP3
• Retinoblastoma-associated protein 1
• Retinoblastoma-binding protein 3
• transcription factor E2F1

Background

E2F1 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: E2F1