Dystrobrevin beta Antibody (1D3) - Azide and BSA Free

ELISA: Dystrobrevin beta Antibody (1D3) [H00001838-M03] - Detection limit for recombinant GST tagged DTNB is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Dystrobrevin beta Antibody (1D3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DTNB (NP_899205, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY
• Specificity: DTNB - dystrobrevin, beta (1D3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DTNB
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dystrobrevin beta Antibody (1D3) - Azide and BSA Free

• beta-dystrobrevin
• DTN-B
• dystrobrevin beta
• dystrobrevin, beta
• MGC17163
• MGC57126

Background

This gene encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTNB
• Entrez:
  • 1838(Human)
• Uniprot:
  • NP_899205(Human)