DYRK3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DYRK3 Antibody [NBP2-57912] - Staining of human cell line SiHa shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DYRK3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DYRK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DYRK3 Recombinant Protein Antigen (NBP2-57912PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DYRK3 Antibody - BSA Free

• dual specificity tyrosine-phosphorylation-regulated kinase 3
• dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
• dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5
• DYRK3
• DYRK5
• EC 2.7.12
• EC 2.7.12.1
• hYAK3-2
• protein kinase Dyrk3
• REDK
• REDKRED
• Regulatory erythroid kinase
• YAK3-2

Background

DYRK3, or dual specificity tyrosine-phosphorylation-regulated kinase 3, is a negative regulator of EPO-dependent erythropoiesis and may place an upper limit on red cell production during stress erythropoiesis. DYRK3 inhibits cell death due to cytokine withdrawal in hematopoietic progenitor cells, and may also act by regulating CREB/CRE signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DYRK3