Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (2G7) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (2G7) - Azide and BSA Free (H00010540-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
DCTN2 (AAH00718, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK |
| Specificity |
DCTN2 - dynactin 2 (p50) |
| Isotype |
IgG1 Lambda |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DCTN2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (2G7) - Azide and BSA Free
Background
This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (H00010540-M01)(1)
Showing Publication 1 -
1 of 1.
| Publication using H00010540-M01 |
Applications |
Species |
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
|
|
Reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (H00010540-M01) (0)
There are no reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (H00010540-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (H00010540-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dynactin Subunit 2/DCTN2/DCTN-50 Products
Research Areas for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (H00010540-M01)
Find related products by research area.
|
Blogs on Dynactin Subunit 2/DCTN2/DCTN-50