We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen

Images

 
There are currently no images for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dynactin Subunit 1/DCTN1

Source: E.coli

Amino Acid Sequence: KDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCTN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24804It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen

  • DAP-150
  • DCTN1
  • DP-150
  • dynactin 1 (p150, Glued (Drosophila) homolog)
  • Dynactin 1
  • Dynactin Subunit 1
  • glued homolog, Drosophila)
  • HMN7B
  • p135
  • p150 Glued (Drosophila) homolog
  • p150-glued

Background

The DCTN1 gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein. Alternative splicing of this gene results in at least 2 functionally distinct isoforms: a ubiquitously expressed one and a brain-specific one. Based on its cytogenetic location, this gene is considered as a candidate gene for limb-girdle muscular dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-68205
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
NBP1-80903
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-94712
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1436
Species: Mu
Applications: WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92902
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB4987
Species: Hu, Mu, Rt
Applications: WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP3-24804PEP
Species: Hu
Applications: AC

Publications for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP) (0)

There are no publications for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP) (0)

There are no reviews for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dynactin Subunit 1/DCTN1 Products

Research Areas for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen (NBP3-24804PEP)

Find related products by research area.

Blogs on Dynactin Subunit 1/DCTN1

There are no specific blogs for Dynactin Subunit 1/DCTN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTN1