Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen

Images

 
There are currently no images for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCTN1.

Source: E.coli

Amino Acid Sequence: RELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCTN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33976.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen

  • DAP-150
  • DCTN1
  • DP-150
  • dynactin 1 (p150, Glued (Drosophila) homolog)
  • Dynactin 1
  • Dynactin Subunit 1
  • glued homolog, Drosophila)
  • HMN7B
  • p135
  • p150 Glued (Drosophila) homolog
  • p150-glued

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NB100-68205
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NBP1-94712
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC-Fr, IP
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18878
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33976PEP
Species: Hu
Applications: AC

Publications for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP) (0)

There are no publications for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP) (0)

There are no reviews for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dynactin Subunit 1/DCTN1 Products

Bioinformatics Tool for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP)

Discover related pathways, diseases and genes to Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP)

Discover more about diseases related to Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP).
 

Pathways for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP)

View related products by pathway.

PTMs for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP)

Learn more about PTMs related to Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP).
 

Research Areas for Dynactin Subunit 1/DCTN1 Protein (NBP2-33976PEP)

Find related products by research area.

Blogs on Dynactin Subunit 1/DCTN1

There are no specific blogs for Dynactin Subunit 1/DCTN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dynactin Subunit 1/DCTN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTN1