DUSP15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DUSP15 Antibody [NBP2-57320] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining in human testis and endometrium tissues using anti-DUSP15 antibody. Corresponding DUSP15 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DUSP15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA',)
Specificity
Specificity of human DUSP15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DUSP15 Antibody

  • dual specificity phosphatase 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01507
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31232
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67909
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
MAB7475
Species: Hu, Rt
Applications: WB
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1042
Species: Mu
Applications: WB, IHC
AF4937
Species: Hu
Applications: WB, IHC
NBP2-10509
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB1654
Species: Hu, Mu, Rt
Applications: WB
NBP2-57758
Species: Hu
Applications: ICC/IF
NBP2-13827
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57320
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DUSP15 Antibody (NBP2-57320) (0)

There are no publications for DUSP15 Antibody (NBP2-57320).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP15 Antibody (NBP2-57320) (0)

There are no reviews for DUSP15 Antibody (NBP2-57320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DUSP15 Antibody (NBP2-57320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DUSP15 Products

Bioinformatics Tool for DUSP15 Antibody (NBP2-57320)

Discover related pathways, diseases and genes to DUSP15 Antibody (NBP2-57320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP15 Antibody (NBP2-57320)

Discover more about diseases related to DUSP15 Antibody (NBP2-57320).
 

Pathways for DUSP15 Antibody (NBP2-57320)

View related products by pathway.

PTMs for DUSP15 Antibody (NBP2-57320)

Learn more about PTMs related to DUSP15 Antibody (NBP2-57320).
 

Research Areas for DUSP15 Antibody (NBP2-57320)

Find related products by research area.

Blogs on DUSP15

There are no specific blogs for DUSP15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP15