Home » DUSP15 » DUSP15 Antibodies » DUSP15 Antibody

DUSP15 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: DUSP15 Antibody [NBP2-57320] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunocytochemistry/ Immunofluorescence: DUSP15 Antibody [NBP2-57320] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining in human testis and endometrium tissues using anti-DUSP15 antibody. Corresponding DUSP15 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

DUSP15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA',)
Specificity
Specificity of human DUSP15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DUSP15 Antibody

  • dual specificity phosphatase 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DUSP22 Antibody
NBP1-83078
Western Blot: DUSP22 Antibody [NBP1-83078] - Analysis in control (vector only transfected HEK293T lysate) and DUSP22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: DUSP22 Antibody [NBP1-83078] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DUSP23 Antibody
(OTI3C10)
NBP2-01507
Western Blot: DUSP23 Antibody (3C10) [NBP2-01507] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DUSP23 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DUSP23.
Immunocytochemistry/Immunofluorescence: DUSP23 Antibody (OTI3C10) [NBP2-01507] - DUSP23 Antibody (3C10) [NBP2-01507] Staining of COS7 cells transiently transfected by pCMV6-ENTRY DUSP23.
Immunohistochemistry-Paraffin: DUSP23 Antibody (3C10) [NBP2-01507] - Staining of paraffin-embedded Human tonsil using anti-DUSP23 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DUSP7 Antibody
NBP1-31232
Western Blot: DUSP7 Antibody [NBP1-31232] - Sample (30ug whole cell lysate) A:Raji 10% SDS PAGE, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: DUSP7 Antibody [NBP1-31232] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: DUSP7 Antibody [NBP1-31232] - Paraffin-embedded NCIN87 xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MKP-1/DUSP1
Antibody (JJ0930)
NBP2-67909
Western Blot: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of DUSP1 on mouse spleen lysates using anti-DUSP1 antibody at 1/1,000 dilution.
Immunohistochemistry-Paraffin: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of paraffin-embedded mouse lung tissue using anti-DUSP1 antibody. Counter stained with hematoxylin.
Flow Cytometry: MKP-1/DUSP1 Antibody (JJ0930) [NBP2-67909] - Analysis of HepG2 cells with DUSP1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
MKK4/MEK4 Antibody
(OTI8A8)
NBP1-47839
Western Blot: MKK4/MEK4 Antibody (8A8) [NBP1-47839] - Analysis of extracts (35ug) from 9 different cell lines by using anti-MEK4 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: MKK4/MEK4 Antibody (8A8) [NBP1-47839] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MEK4.
Immunohistochemistry-Paraffin: MKK4/MEK4 Antibody (8A8) [NBP1-47839] - Staining of paraffin-embedded Human thyroid tissue using anti-MEK4 mouse monoclonal antibody.
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SLC25A3 Antibody
H00005250-B02P
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in human pancreas.
Immunocytochemistry/Immunofluorescence: SLC25A3 Antibody [H00005250-B02P] - Analysis of purified antibody to SLC25A3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: SLC25A3 Antibody [H00005250-B02P] - Analysis of SLC25A3 expression in transfected 293T cell line by SLC25A3 polyclonal antibody. Lane 1: SLC25A3 transfected lysate(39.71 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ICC/IF
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western blot shows lysates of human brain (cerebellum) tissue and rat brain tissue. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human PTPπ/PTPRU Monoclonal Antibody (Catalog # MAB7475) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PTPπ/PTPRU at approximately 180-200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Rt
Applications: WB
Snx6 Antibody
NBP2-13361
Western Blot: Snx6 Antibody [NBP2-13361] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Snx6 Antibody [NBP2-13361] - Staining of human cell line U-2 OS shows localization to endosomes & lysosomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PDGF R beta
Antibody [Unconjugate
AF1042
PDGF R beta was detected in immersion fixed frozen sections of mouse embryo spinal cord using 5 µg/mL Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of rat spinal cord tissue, rat brain tissue, and mouse brain tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDGF R beta at approximately 190 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(22 Publications)
Species: Mu
Applications: WB, IHC
Reg1A Antibody
AF4937
Western blot shows lysates of human pancreas tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Reg1A at approximately 20-22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Reg1A was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
CDR2 Antibody (33)
NBP2-10509
Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa control cell lysate and 2) HeLa cell lysate overexpressing CDR2.
Immunohistochemistry: CDR2 Antibody (33) [NBP2-10509] - IHC staining of CDR2 in human breast cancer using DAB with hematoxylin counterstain.
Western Blot: CDR2 Antibody (33) [NBP2-10509] - Western blot analysis of CDR2 expression in 1) HeLa, 2) NTERA-2 and 3) HepG2 whole cell lysates.
(1 Publication)
Species: Hu, Mu(-)
Applications: WB, ELISA, IHC, IHC-P, IP
JNK1 Antibody
(228601) [Unconjugate
MAB17761
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC
VHR/DUSP3 Antibody
(237020)
MAB1654
Western blot shows lysates of TE-85 human osteogenic sarcoma cell line, TF-1 human erythroleukemic cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.5 µg/mL Mouse Anti-Human/Mouse/Rat VHR Monoclonal Antibody (Catalog # MAB1654) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). For additional reference, Recombinant Human VHR (Catalog # 1654-VH) (2 ng) was included. A specific band for VHR was detected at approximately 24 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
CDR1 Antibody
NBP2-57758
Immunocytochemistry/Immunofluorescence: CDR1 Antibody [NBP2-57758] - Staining of human cell line BJ shows localization to nucleoplasm, the Golgi apparatus & centrosome. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
PTPMT1 Antibody
NBP2-13827
Immunocytochemistry/Immunofluorescence: PTPMT1 Antibody [NBP2-13827] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: PTPMT1 Antibody [NBP2-13827] - Staining of human testis shows positivity in Leydig cells and ells in seminiferous ducts.
Immunohistochemistry-Paraffin: PTPMT1 Antibody [NBP2-13827] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DUSP15 Antibody
NBP2-57320
DUSP15 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DUSP15 Antibody (NBP2-57320) (0)

There are no publications for DUSP15 Antibody (NBP2-57320).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP15 Antibody (NBP2-57320) (0)

There are no reviews for DUSP15 Antibody (NBP2-57320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DUSP15 Antibody (NBP2-57320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional DUSP15 Products

Bioinformatics Tool for DUSP15 Antibody (NBP2-57320)

Discover related pathways, diseases and genes to DUSP15 Antibody (NBP2-57320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP15 Antibody (NBP2-57320)

Discover more about diseases related to DUSP15 Antibody (NBP2-57320).
 

Pathways for DUSP15 Antibody (NBP2-57320)

View related products by pathway.

PTMs for DUSP15 Antibody (NBP2-57320)

Learn more about PTMs related to DUSP15 Antibody (NBP2-57320).
 

Research Areas for DUSP15 Antibody (NBP2-57320)

Find related products by research area.

Blogs on DUSP15

There are no specific blogs for DUSP15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP15 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DUSP15