DUSP15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DUSP15 Antibody [NBP2-57320] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.

Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining in human testis and endometrium tissues using anti-DUSP15 antibody. Corresponding DUSP15 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: DUSP15 Antibody [NBP2-57320] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DUSP15 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA',)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DUSP15 Recombinant Protein Antigen (NBP2-57320PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DUSP15 Antibody - BSA Free

• dual specificity phosphatase 15

Background

DUSP15 is encoded by this gene belongs to the non-receptor class of the protein-tyrosine phosphatase family. The encoded protein has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP15