We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DUOX1 Recombinant Protein Antigen

Images

 
There are currently no images for DUOX1 Protein (NBP1-81301PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DUOX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUOX1.

Source: E. coli

Amino Acid Sequence: QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DUOX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81301.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DUOX1 Recombinant Protein Antigen

  • dual oxidase 1
  • DUOX
  • EC 1.11.1.-
  • EC 1.6.3.1
  • Large NOX 1
  • LNOX1flavoprotein NADPH oxidase
  • Long NOX 1
  • MGC138840
  • NADPH thyroid oxidase 1
  • nicotinamide adenine dinucleotide phosphate oxidase
  • NOXEF1
  • THOX1MGC138841
  • Thyroid oxidase 1

Background

The DUOX1 gene encodes a glycoprotein dual oxidase 1 protein with an isoform 1 of 1,551 amino acids long at 177 kDA and an isoform 2 at 1,197 amino acids long at 137 kDA. This protein is called a dual oxidase because it obtains a peroxidase homology domain and a gp91phox domain. DUOX1 generates hydrogen peroxide which is essential for thyroid peroxidase/TPO and lactoperoxidase/LPO, as well as lactoperoxidase-mediated antimicrobial defense. DUOX1 interacts with genes TXNDC11 and TPO and has been investigated for its role in various diseases such as thyroiditis, lung cancer, alcoholism, carcinoma, chronic obstructive pulmonary disease, hypothyroidism, hepatitis, prostatitis, and chronic granulomatous disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61576
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-41012
Species: Hu
Applications: ELISA, Flow-IC, Flow, IHC, IHC-Fr,  IHC-P, WB
NBP1-80670
Species: Hu
Applications: IHC,  IHC-P
NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, PEP-ELISA, WB
NBP1-31546
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB110-58849
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
H00090527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-03403
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-57547
Species: Hu
Applications: IHC,  IHC-P
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for DUOX1 Protein (NBP1-81301PEP) (0)

There are no publications for DUOX1 Protein (NBP1-81301PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUOX1 Protein (NBP1-81301PEP) (0)

There are no reviews for DUOX1 Protein (NBP1-81301PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DUOX1 Protein (NBP1-81301PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DUOX1 Products

Array NBP1-81301PEP

Blogs on DUOX1

There are no specific blogs for DUOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DUOX1 Antibody
NB100-93521

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DUOX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DUOX1