DULLARD Antibody

Western Blot: DULLARD Antibody [NBP1-87961] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: DULLARD Antibody [NBP1-87961] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DULLARD Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTDNEP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DULLARD Protein (NBP1-87961PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DULLARD Antibody

• CTD nuclear envelope phosphatase 1
• dullard homolog (Xenopus laevis)
• dullard homolog
• DULLARD
• EC 3.1.3.16
• HSA011916
• NET56
• Serine/threonine-protein phosphatase dullard

Background

Serine/threonine phosphatase which may be required for proper nuclear membrane morphology. Involved in LPIN1 dephosphorylation. May antagonize BMP signaling

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTDNEP1