DULLARD Antibody

Images

 
Western Blot: DULLARD Antibody [NBP1-87961] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: DULLARD Antibody [NBP1-87961] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DULLARD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTDNEP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DULLARD Protein (NBP1-87961PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DULLARD Antibody

  • CTD nuclear envelope phosphatase 1
  • dullard homolog (Xenopus laevis)
  • dullard homolog
  • DULLARD
  • EC 3.1.3.16
  • HSA011916
  • NET56
  • Serine/threonine-protein phosphatase dullard

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88455
Species: Hu
Applications: IHC, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5310
Species: Hu, Mu
Applications: WB, ICC
NBP1-80628
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00010716-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P

Publications for DULLARD Antibody (NBP1-87961) (0)

There are no publications for DULLARD Antibody (NBP1-87961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DULLARD Antibody (NBP1-87961) (0)

There are no reviews for DULLARD Antibody (NBP1-87961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DULLARD Antibody (NBP1-87961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DULLARD Products

Bioinformatics Tool for DULLARD Antibody (NBP1-87961)

Discover related pathways, diseases and genes to DULLARD Antibody (NBP1-87961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DULLARD Antibody (NBP1-87961)

Discover more about diseases related to DULLARD Antibody (NBP1-87961).
 

Pathways for DULLARD Antibody (NBP1-87961)

View related products by pathway.

PTMs for DULLARD Antibody (NBP1-87961)

Learn more about PTMs related to DULLARD Antibody (NBP1-87961).

Blogs on DULLARD

There are no specific blogs for DULLARD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DULLARD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTDNEP1