Dub3 Antibody - BSA Free

Western Blot: Dub3 Antibody [NBP1-79745] - Human Heart lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Dub3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP17L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Knock down reported in scientific literature (PMID:31533987).
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Dub3 Antibody - BSA Free

• Deubiquitinating enzyme 17-like protein 2
• Deubiquitinating protein 3
• Dub3
• DUB-3
• DUB3deubiquitinating enzyme 3
• EC 3.1.2.15
• EC 3.4.19.12
• -like protein 2
• ubiquitin carboxyl-terminal hydrolase 17-like protein 2
• ubiquitin specific peptidase 17-like 2
• ubiquitin thioesterase 17-like protein 2
• Ubiquitin thiolesterase 17-like protein 2
• Ubiquitin-specific-processing protease 17-like protein 2
• USP17
• USP17H
• USP17I
• USP17J
• USP17K
• USP17L
• USP17L2
• USP17M

Background

The gene DUB3 (also frequently known as USP17L2) codes a ubiquitin carboxyl-terminal hydrolase 17 protein that is 530 amino acids long at 59 kDA. DUB3 has been researched regarding its role in breast cancer. DUB3 is known to interact with various genes such as: USP17L24, USP17L25, USP17L26, USP17L27, and USP17L28. DUB3 assists in regulation of cell proliferation and apoptosis through moderation of the deubiquination of CDC25A, SUDS3, and RCE1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dub3 Antibody (NBP1-79745)(3)

Publications using NBP1-79745

• Fukuura K, Inoue Y, Miyajima C et al. The ubiquitin-specific protease USP17 prevents cellular senescence by stabilizing the methyltransferase SET8 and transcriptionally repressing p21 J. Biol. Chem. 2019-09-18 [PMID: 31533987] (WB, IP, Human)
• Yang D, Hui Y, Bai S et al. DUB3 contributes to colorectal cancer cell migration and angiogenesis via NF-kappa B/HIF-1 alpha ScienceAsia 2022-02-27 (KD, WB, Human)
• Chandrasekaran AP, Tyagi A, Poondla N et al. Dual role of deubiquitinating enzyme USP19 regulates mitotic progression and tumorigenesis by stabilizing survivin Molecular therapy : the journal of the American Society of Gene Therapy 2022-08-01 [PMID: 35918893]

Review for Dub3 Antibody (NBP1-79745) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 11/17/2017

Summary

• Application: Western Blot
• Sample Tested: MDA-231 cell lysate
• Species: Human
• Lot: QC30181-42754

Bioinformatics

• Gene Symbol: USP17L2
• Uniprot:
  • NP_958804(Human)