Dub3 Antibody

Images

 
Western Blot: Dub3 Antibody [NBP1-79745] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dub3 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP17L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against USP17L2 and was validated on Western blot. Use in immunoprecipitation reported in scientific literature (PMID:31533987).
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-79745 in the following applications:

Publications
Read Publications using
NBP1-79745 in the following applications:

  • IP
    1 publication
  • KD
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dub3 Antibody

  • Deubiquitinating enzyme 17-like protein 2
  • Deubiquitinating protein 3
  • Dub3
  • DUB-3
  • DUB3deubiquitinating enzyme 3
  • EC 3.1.2.15
  • EC 3.4.19.12
  • -like protein 2
  • ubiquitin carboxyl-terminal hydrolase 17-like protein 2
  • ubiquitin specific peptidase 17-like 2
  • ubiquitin thioesterase 17-like protein 2
  • Ubiquitin thiolesterase 17-like protein 2
  • Ubiquitin-specific-processing protease 17-like protein 2
  • USP17
  • USP17H
  • USP17I
  • USP17J
  • USP17K
  • USP17L
  • USP17L2
  • USP17M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1648
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-86906
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP2-55335
Species: Hu
Applications: ICC/IF, WB
D6050
Species: Hu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-59922
Species: Hu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
AF4859
Species: Hu
Applications: WB
NB600-260
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-257
Species: Hu, Mu
Applications: IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
1726-JG
Species: Hu
Applications: BA
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-79745
Species: Hu
Applications: WB, IP

Publications for Dub3 Antibody (NBP1-79745)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: IP, KD, WB.


Filter By Application
IP
(1)
KD
(1)
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-79745 Applications Species
Fukuura K, Inoue Y, Miyajima C et al. The ubiquitin-specific protease USP17 prevents cellular senescence by stabilizing the methyltransferase SET8 and transcriptionally repressing p21 J. Biol. Chem. Sep 18 2019 [PMID: 31533987] (IP, WB, Human) IP, WB Human
Yang D, Hui Y, Bai S et al. DUB3 contributes to colorectal cancer cell migration and angiogenesis via NF-kappa B/HIF-1 alpha ScienceAsia Feb 27 2022 (WB, KD, Human) WB, KD Human

Review for Dub3 Antibody (NBP1-79745) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-79745:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Dub3 NBP1-79745
Enlarge
5
reviewed by:
Yasumichi Inoue
Western Blot Human 11/17/2017
View

Summary

ApplicationWestern Blot
Sample TestedMDA-231 cell lysate
SpeciesHuman
LotQC30181-42754

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dub3 Antibody (NBP1-79745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dub3 Products

Array NBP1-79745

Bioinformatics Tool for Dub3 Antibody (NBP1-79745)

Discover related pathways, diseases and genes to Dub3 Antibody (NBP1-79745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dub3 Antibody (NBP1-79745)

Discover more about diseases related to Dub3 Antibody (NBP1-79745).
 

Pathways for Dub3 Antibody (NBP1-79745)

View related products by pathway.

Blogs on Dub3

There are no specific blogs for Dub3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Yasumichi Inoue
11/17/2017
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol USP17L2
Uniprot