Dub3 Antibody - BSA Free

Images

 
Western Blot: Dub3 Antibody [NBP1-79745] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

Dub3 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP17L2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
Application Notes
Use in Knock down reported in scientific literature (PMID:31533987).
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-79745 in the following applications:

Publications
Read Publications using
NBP1-79745 in the following applications:

  • IP
    1 publication
  • KD
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Dub3 Antibody - BSA Free

  • Deubiquitinating enzyme 17-like protein 2
  • Deubiquitinating protein 3
  • Dub3
  • DUB-3
  • DUB3deubiquitinating enzyme 3
  • EC 3.1.2.15
  • EC 3.4.19.12
  • -like protein 2
  • ubiquitin carboxyl-terminal hydrolase 17-like protein 2
  • ubiquitin specific peptidase 17-like 2
  • ubiquitin thioesterase 17-like protein 2
  • Ubiquitin thiolesterase 17-like protein 2
  • Ubiquitin-specific-processing protease 17-like protein 2
  • USP17
  • USP17H
  • USP17I
  • USP17J
  • USP17K
  • USP17L
  • USP17L2
  • USP17M

Background

The gene DUB3 (also frequently known as USP17L2) codes a ubiquitin carboxyl-terminal hydrolase 17 protein that is 530 amino acids long at 59 kDA. DUB3 has been researched regarding its role in breast cancer. DUB3 is known to interact with various genes such as: USP17L24, USP17L25, USP17L26, USP17L27, and USP17L28. DUB3 assists in regulation of cell proliferation and apoptosis through moderation of the deubiquination of CDC25A, SUDS3, and RCE1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1648
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-86906
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-55335
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NB600-1131
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP3-35836
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56749
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC,  IHC-P, PEP-ELISA
AF4859
Species: Hu
Applications: WB
NB600-260
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-257
Species: Hu, Mu
Applications: IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-75547
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
1726-JG
Species: Hu
Applications: BA
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-79745
Species: Hu
Applications: WB, KD

Publications for Dub3 Antibody (NBP1-79745)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: IP, KD, WB.


Filter By Application
IP
(1)
KD
(1)
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Review for Dub3 Antibody (NBP1-79745) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-79745:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Dub3 NBP1-79745
Enlarge
5
reviewed by:
Verified Customer
WB Human 11/17/2017
View

Summary

ApplicationWestern Blot
Sample TestedMDA-231 cell lysate
SpeciesHuman
LotQC30181-42754

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dub3 Antibody (NBP1-79745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
11/17/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol USP17L2
Uniprot