DTX2 Antibody

Images

 
Western Blot: DTX2 Antibody [NBP1-53119] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTX2 Antibody Summary

Immunogen
Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DTX2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DTX2 Antibody

  • deltex (Drosophila) homolog 2
  • deltex homolog 2 (Drosophila)
  • Deltex2
  • hDTX2
  • MGC71098
  • protein deltex-2
  • RING finger protein 58
  • RNF58KIAA1528deltex2
  • zinc ion binding protein

Background

DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91612
Species: Mu
Applications: WB
NBP2-31789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4079
Species: Hu
Applications: WB, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-32276
Species: Hu
Applications: WB, IP
AF4409
Species: Mu
Applications: WB
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2388
Species: Hu
Applications: WB, IHC
NBP1-53119
Species: Hu
Applications: WB

Publications for DTX2 Antibody (NBP1-53119) (0)

There are no publications for DTX2 Antibody (NBP1-53119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX2 Antibody (NBP1-53119) (0)

There are no reviews for DTX2 Antibody (NBP1-53119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DTX2 Antibody (NBP1-53119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTX2 Products

Bioinformatics Tool for DTX2 Antibody (NBP1-53119)

Discover related pathways, diseases and genes to DTX2 Antibody (NBP1-53119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX2 Antibody (NBP1-53119)

Discover more about diseases related to DTX2 Antibody (NBP1-53119).
 

Pathways for DTX2 Antibody (NBP1-53119)

View related products by pathway.

PTMs for DTX2 Antibody (NBP1-53119)

Learn more about PTMs related to DTX2 Antibody (NBP1-53119).
 

Research Areas for DTX2 Antibody (NBP1-53119)

Find related products by research area.

Blogs on DTX2

There are no specific blogs for DTX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX2
Uniprot