We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DTX1 Recombinant Protein Antigen

Images

 
There are currently no images for DTX1 Recombinant Protein Antigen (NBP2-58472PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DTX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DTX1.

Source: E. coli

Amino Acid Sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DTX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58472.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DTX1 Recombinant Protein Antigen

  • deltex homolog 1 (Drosophila)
  • Deltex1
  • DTX1
  • Dx-1
  • hDTX1
  • hDx-1
  • protein deltex-1

Background

DTX1, also known as E3 ubiquitin-protein ligase DTX1, is a 67.4 kDa, 620 amino acid protein that is involved in regulating the Notch pathway by monitoring ubiquitination and stimulating the breakdown of MEKK1. Current research is being conducted with diseases and disorders such as osteosarcoma, Noonan syndrome, and neuronitis. The protein interacts in disease and Notch signaling pathways with CRK, ITCH, UBE2D2, UBE2D3, and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP2-13941
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
MPTX20
Species: Mu
Applications: ELISA
MAB9080
Species: Hu
Applications: WB
AF7388
Species: Hu
Applications: IHC
AF3735
Species: Hu
Applications: IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF3847
Species: Hu
Applications: ICC, WB
MAB7650
Species: Mu
Applications: IHC, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-31789
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for DTX1 Recombinant Protein Antigen (NBP2-58472PEP) (0)

There are no publications for DTX1 Recombinant Protein Antigen (NBP2-58472PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX1 Recombinant Protein Antigen (NBP2-58472PEP) (0)

There are no reviews for DTX1 Recombinant Protein Antigen (NBP2-58472PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DTX1 Recombinant Protein Antigen (NBP2-58472PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DTX1 Products

Array NBP2-58472PEP

Research Areas for DTX1 Recombinant Protein Antigen (NBP2-58472PEP)

Find related products by research area.

Blogs on DTX1

There are no specific blogs for DTX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DTX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX1