BAAT1 Antibody


Western Blot: BAAT1 Antibody [NBP1-88366] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry: BAAT1 Antibody [NBP1-88366] - Staining of human kidney shows strong membranous positivity in glomerular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

BAAT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPG
Specificity of human BAAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAAT1 Protein (NBP1-88366PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BAAT1 Antibody

  • BAAT1
  • BRCA1-associated ATM activator 1
  • BRCA1-associated protein required for ATM activation protein 1
  • C7orf27
  • chromosome 7 open reading frame 27
  • HEAT repeat-containing protein C7orf27
  • MGC22916


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for BAAT1 Antibody (NBP1-88366) (0)

There are no publications for BAAT1 Antibody (NBP1-88366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAAT1 Antibody (NBP1-88366) (0)

There are no reviews for BAAT1 Antibody (NBP1-88366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAAT1 Antibody (NBP1-88366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BAAT1 Products

Bioinformatics Tool for BAAT1 Antibody (NBP1-88366)

Discover related pathways, diseases and genes to BAAT1 Antibody (NBP1-88366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAAT1 Antibody (NBP1-88366)

Discover more about diseases related to BAAT1 Antibody (NBP1-88366).

PTMs for BAAT1 Antibody (NBP1-88366)

Learn more about PTMs related to BAAT1 Antibody (NBP1-88366).

Research Areas for BAAT1 Antibody (NBP1-88366)

Find related products by research area.

Blogs on BAAT1

There are no specific blogs for BAAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BAAT1 Antibody and receive a gift card or discount.


Gene Symbol BRAT1