BAAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BAAT1 Antibody [NBP1-88366] - Staining of human Lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: BAAT1 Antibody [NBP1-88366] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: BAAT1 Antibody [NBP1-88366] - Staining of human Kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: BAAT1 Antibody [NBP1-88366] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and BRAT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BAAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BAAT1 Antibody - BSA Free (NBP1-88366) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100-1:250
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BAAT1 Protein (NBP1-88366PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BAAT1 Antibody - BSA Free

• BAAT1
• BRCA1-associated ATM activator 1
• BRCA1-associated protein required for ATM activation protein 1
• C7orf27
• chromosome 7 open reading frame 27
• HEAT repeat-containing protein C7orf27
• MGC22916

Background

BAAT1 (BRCA1-associated protein required for ATM activation-1) was identified by yeast two hybrid analysis. BAAT1 binds to ATM, localizes to double-strand breaks, and is required for Ser1981 phosphorylation of ATM.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRAT1