DRAK2 Antibody

Images

 
Western Blot: DRAK2 Antibody [NBP1-84980] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: DRAK2 Antibody [NBP1-84980] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRAK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK17B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DRAK2 Protein (NBP1-84980PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DRAK2 Antibody

  • DAP kinase-related apoptosis-inducing protein kinase 2
  • DRAK2
  • DRAK2death-associated protein kinase-related 2
  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 17b (apoptosis-inducing)
  • serine/threonine kinase 17b
  • serine/threonine-protein kinase 17B
  • STK17B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76896
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
H00005535-T01
Species: Hu
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P

Publications for DRAK2 Antibody (NBP1-84980) (0)

There are no publications for DRAK2 Antibody (NBP1-84980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRAK2 Antibody (NBP1-84980) (0)

There are no reviews for DRAK2 Antibody (NBP1-84980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DRAK2 Antibody (NBP1-84980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRAK2 Products

Bioinformatics Tool for DRAK2 Antibody (NBP1-84980)

Discover related pathways, diseases and genes to DRAK2 Antibody (NBP1-84980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRAK2 Antibody (NBP1-84980)

Discover more about diseases related to DRAK2 Antibody (NBP1-84980).
 

Pathways for DRAK2 Antibody (NBP1-84980)

View related products by pathway.

PTMs for DRAK2 Antibody (NBP1-84980)

Learn more about PTMs related to DRAK2 Antibody (NBP1-84980).
 

Research Areas for DRAK2 Antibody (NBP1-84980)

Find related products by research area.

Blogs on DRAK2

There are no specific blogs for DRAK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRAK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK17B
Entrez