DPP6 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to DPP6(dipeptidyl-peptidase 6) The peptide sequence was selected from the middle region of DPP6.
Peptide sequence AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DPP6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DPP6 Antibody - BSA Free
Background
DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, In
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: Dual ISH-IHC, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Publications for DPP6 Antibody (NBP1-59925) (0)
There are no publications for DPP6 Antibody (NBP1-59925).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DPP6 Antibody (NBP1-59925) (0)
There are no reviews for DPP6 Antibody (NBP1-59925).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DPP6 Antibody (NBP1-59925) (0)