DPF2 Antibody (2F6) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK |
| Localization |
Cytoplasmic and Nuclear. Note=30% nuclear. 70% cytoplasmic. |
| Specificity |
DPF2 - D4, zinc and double PHD fingers family 2 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
DPF2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DPF2 Antibody (2F6) - Azide and BSA Free
Background
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Publications for DPF2 Antibody (H00005977-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for DPF2 Antibody (H00005977-M01) (0)
There are no reviews for DPF2 Antibody (H00005977-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DPF2 Antibody (H00005977-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DPF2 Products
Research Areas for DPF2 Antibody (H00005977-M01)
Find related products by research area.
|
Blogs on DPF2